Candidatus Solibacter usitatus: Acid_7809 Help Entry Acid_7809         CDS       T00412                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sus  Candidatus Solibacter usitatus Pathway sus01100   Metabolic pathways sus01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sus00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Acid_7809    00074 Mycolic acid biosynthesis     Acid_7809   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Acid_7809 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF4518 Motif Other DBs NCBI-ProteinID:  ABJ88707 UniProt:  Q01NR3 LinkDB All DBs Position complement(9786371..9786604) Genome browser AA seq 77 aa AA seqDB search MSEQVLTRVQQIASDVLLADVTADSSPETVESWDSVQHLNLILAVEEEYGFQFSPEEMDG AKTVGAIAGLVAARRGV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgaacaggtattgacccgggttcaacaaatcgcctccgatgtcctgctggcagac gtcaccgccgactcctcgccggagacggtggaaagctgggattcggtacagcatttgaac ctcattctcgcggtggaagaggagtacggattccagttttcgcccgaggaaatggatggc gcgaagactgtgggagcgatcgccggcctggttgcggcccggcgcggcgtctga

DBGET integrated database retrieval system