Sulfitobacter sp. S190: K3756_00145
Help
Entry
K3756_00145 CDS
T10858
Symbol
addA
Name
(GenBank) double-strand break repair helicase AddA
KO
K16898
ATP-dependent helicase/nuclease subunit A [EC:
5.6.2.4
3.1.-.-]
Organism
susq Sulfitobacter sp. S190
Brite
KEGG Orthology (KO) [BR:
susq00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
susq03400
]
K3756_00145 (addA)
Enzymes [BR:
susq01000
]
5. Isomerases
5.6 Isomerases altering macromolecular conformation
5.6.2 Enzymes altering nucleic acid conformation
5.6.2.4 DNA 3'-5' helicase
K3756_00145 (addA)
DNA repair and recombination proteins [BR:
susq03400
]
Prokaryotic type
DSBR (double strand breaks repair)
HR (homologous recombination)
AddAB pathway proteins
K3756_00145 (addA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UvrD-helicase
AAA_19
UvrD_C
UvrD_C_2
PDDEXK_1
AAA_30
Motif
Other DBs
NCBI-ProteinID:
UWR22455
LinkDB
All DBs
Position
29892..33272
Genome browser
AA seq
1126 aa
AA seq
DB search
MKAPDWNDATRAQVTAASPDTSTWLSANAGSGKTRVLTDRVARLLLNRVEPQHILCLTYT
KAAASEMQNRLFRRLGDWAMMDDDDLRPTLLEMGVLQDLDAEDLRRARTLFAQAIETPGG
LKIQTIHSFCAALLRRFPLEAGVSPQFKEIEDRAAELLRAEIVDAMADGPDAPLVAGIAK
FYTGESFGKLTQSIASQREAFDAAGQGVDLNALFDLPPHFDAADLPAWVIDKSVASWLPT
AIGVLRGQSATMVKLADTLDTIDVQAPDADMLQLLKELFLYRDKSVLKPEAKTKSVPTKK
AQEALGPTLIAFHDLMERTAQAHDMELRARNVARTGALHAFARSFIDRYEAKKVERGLLD
FDDLILRARTLLTDPKVAAWVLYRIDGGIDHILVDEAQDTSPRQWDVIERLTDEFTSGAG
ARAKEDRTLFVVGDKKQSIYSFQGADPREFDAKRESFANRFGAVDLPFSAETLDYSFRSS
DAILTAVDQTLNPRIDERMHHLAFKDRLPGRVDLWPLVEPQGDEEEGAWYEPLDRKSPQH
HSVVLGQQVADQIKYLVEGDHYIPADGPDKTTVRRRITPGDFLILVQGRSDLFAEIIRAC
KAADLPIAGADRLKVAAELAVRDIGALLAFLATPEDSLSLATTLRSPLFGWSEQQLFTLA
HGRSEKHLWQALRTQTDIHPETVSVLQDLRGQIDFLRPYDLIERLLTRHGGRARLLARLG
TEAEDGIDALLAQALAYEQSDIPSLTRFLEWMETDDLEIKRQIDSASDQIRVMTVHGAKG
LEAPIVILPDTALRADTVKDEIITMEGVPIWKPGAAEITQRVSTRLTEIKEAQRQERLRL
LYVAMTRAEKWLIVAAAGRLNKEPDSWYQMIEQALGHLNAVPFSEGPSHGLRYQTHDWDG
LPVKAVQRQTRKTPELDPLFIRKIGQLPDRQETITPSSFEGAKALAGDTGQDEEAAKAYG
TLVHLLLEHLAPLPAGDRYDVAVRLTATRPAEVASRAIAEAMDVLAAPALAPIFAPDALA
EVAVTADLGGTPMYGIIDRLIIGERDVLAVDFKTNRTVPEHAADTPEGLLRQMGAYGHAL
QQVYPDKNIRCAILWTQAQTLMELGPDAIKGALFRSGHLDAGQPRS
NT seq
3381 nt
NT seq
+upstream
nt +downstream
nt
atgaaggcgcccgactggaacgacgccacgcgcgcacaggtcacggcggcaagcccggac
acatcgacatggttgtcggccaacgcggggtcgggcaagacccgtgtcctgaccgaccgg
gtggcgcggttgctgctgaaccgggtcgagccgcagcatatcctgtgcctgacctatacc
aaggccgccgcctcggagatgcagaaccgcctgttccgccgcttgggcgactgggccatg
atggacgatgacgatctacggcccaccctccttgagatgggcgtgctgcaggatctggac
gcggaggacttgcgccgcgcacgcacgctgtttgcccaagcgattgaaacgcccggcggg
ttgaagatccagacgatccactcgttttgtgccgccttgctgcgccgctttccgctggag
gccggtgtcagcccgcagttcaaggaaatcgaggaccgtgccgccgaattgctgcgtgca
gagattgtcgacgcgatggccgacgggccggatgcgccgctggtggcgggtatcgcgaaa
ttctatacgggcgaaagctttggcaagttgacgcaatccatcgcgtcacagcgcgaggct
ttcgacgccgccggtcagggcgttgatctgaatgccctgttcgatctgccaccgcatttt
gacgccgccgatctgccggcgtgggtcatcgacaaatccgtcgcgtcatggctgccgact
gcgatcggggtgctgcgcgggcagtcggcgacgatggtcaaactggccgatacgctcgac
acaatcgacgttcaggcgccggatgccgatatgctgcaactgctcaaggagctgttcttg
taccgcgacaagagtgtcctgaagccagaagcaaagacaaaatccgtgccgaccaagaag
gcgcaggaagcattgggcccgacgcttatcgcgtttcacgacctgatggagcggaccgca
caggcgcatgacatggaactgcgggcgcgcaatgtcgcgcgaaccggtgcgctgcatgct
tttgcgcggtcctttatcgaccgctacgaggcgaagaaggttgaacgcggcctgctggat
tttgacgatctgatcctgcgggcgcggactttgctgaccgatccgaaggtcgccgcgtgg
gtgttgtatcggatcgatggcgggatcgaccatattctggtggacgaggcgcaggacaca
tcgccgcgccaatgggacgtgatcgagcggttgaccgatgaattcaccagcggcgcgggc
gcacgggccaaagaggaccggacgcttttcgttgtcggtgacaagaagcagtcgatctat
tcctttcagggtgccgatccgcgcgaattcgatgccaagcgcgagagtttcgcaaaccgc
tttggcgcggttgatctgccgttcagcgcggagaccctggactattcgttccggtcgtcc
gatgccattctcacggcggtcgaccagacgttgaacccccggatcgatgagcgcatgcac
caccttgccttcaaggacagattgccgggacgggtggatttgtggccccttgtcgagccg
cagggcgatgaggaggagggcgcgtggtacgagccgctggaccgtaaaagcccgcaacac
catagcgttgttctgggtcagcaggtcgccgaccagatcaaatatcttgtggagggggat
cactatatcccggcggacggaccggacaaaaccaccgtgcgcagacgcatcacgcccggc
gattttctgatccttgtgcaggggcgcagtgatctttttgccgagatcatccgggcctgc
aaggccgccgatttgccgattgcgggggcggaccggttgaaagtggctgcggagctggcg
gtgcgcgatatcggggcattgttggcatttctggccacgccggaggacagtctttcgctg
gcaaccacgctgcgctcacccctttttgggtggagcgaacagcagttgttcactctggcg
cacgggcgatcggaaaaacacctctggcaagcgctgcggacgcagacggacatacacccc
gaaacagtctctgttctgcaggatttgcgcggtcagatcgatttcttgcggccctatgac
ctgatcgaacggctgttgacgcggcacggcgggcgggcgcggctgctggcccgtttggga
accgaggcggaggacggtattgatgcgctcttggcgcaggcgctggcctatgagcagagc
gacattccgagcctgaccagatttctggagtggatggagaccgacgatttggaaatcaaa
cgccagatcgacagcgcgtcggaccagatccgcgtgatgacggtacacggagccaaaggg
ctcgaagcgccgatcgtgattttgcccgacacagccctgcgcgcggatactgtcaaggac
gagatcatcacgatggaaggcgtgccgatctggaaacccggcgcggccgaaatcacccag
cgggtcagcacgcggctcaccgagataaaggaggcgcagcggcaagaacgcctgcggttg
ctgtatgtggcgatgacgcgtgcggaaaaatggctgatcgtggccgccgccgggcggctg
aacaaggagccggacagctggtaccagatgatcgaacaggcgctgggccacctgaacgcg
gtgccgttttcggaaggcccgtcgcacggtctgcgctatcaaacccacgactgggacggc
ctgccggtgaaagcggttcagcggcagacacggaaaacccccgaattagacccgcttttc
atccgaaagatcgggcaattgccggatcgccaagagaccatcacgccctcttcgttcgag
ggtgccaaggcgctggccggtgacaccggtcaggacgaggaggcggcgaaggcttatggc
acattggtgcatttactgctggagcatctggcccccctgcccgccggtgacaggtacgat
gttgcggtccggttgacagcgactcgccccgccgaggttgcatcgcgcgccattgcggag
gcgatggatgtgctggccgcgccggcgttggccccgatttttgcgccggatgcgctcgcg
gaagtcgcggttaccgcagatttgggcggcacgccgatgtacggtatcatcgaccggttg
atcatcggcgagcgggacgttctggccgtggatttcaagacaaatcgcacggttcccgag
catgccgccgacacgccagaggggttgttgcgccagatgggggcatacggccacgcgctg
cagcaggtgtatcccgataaaaacatccgctgcgcgatcctgtggacacaggcgcaaacg
ttgatggaactgggtcccgacgcgatcaagggcgcattgttccgcagtggtcatcttgac
gcaggtcagccgcgttcatag
DBGET
integrated database retrieval system