Sulfitobacter sp. S190: K3756_08250 Help Entry K3756_08250       CDS       T10858                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism susq  Sulfitobacter sp. S190 Pathway susq00998   Biosynthesis of various antibiotics susq01100   Metabolic pathways susq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:susq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K3756_08250    00074 Mycolic acid biosynthesis     K3756_08250   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K3756_08250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF3251 Motif Other DBs NCBI-ProteinID:  UWR23926 LinkDB All DBs Position 1627395..1627652 Genome browser AA seq 85 aa AA seqDB search MNIQQQVIAIIAEQAVLEPDDVQMDSTLESLGIDSLGLVESIFAIEEAFDISVPFNANAP QESDFDISTVASIVDGIKRLKAEQG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaatatccagcaacaagtcattgcaatcattgccgaacaggcggttcttgagcccgat gatgtgcagatggacagcacgctcgaaagtctgggtatcgacagtctcggtctggtcgaa agcattttcgcgatcgaggaggcattcgacatctcggtgcccttcaacgccaatgcgccg caggaatccgatttcgacatctccacagtcgccagcatcgtggatggaataaagcggttg aaagccgaacaggggtag

DBGET integrated database retrieval system