Sutterella faecalis: FG381_00690 Help Entry FG381_00690       CDS       T06027                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism sutk  Sutterella faecalis Brite KEGG Orthology (KO) [BR:sutk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sutk03036]     FG381_00690    03400 DNA repair and recombination proteins [BR:sutk03400]     FG381_00690 Chromosome and associated proteins [BR:sutk03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     FG381_00690 DNA repair and recombination proteins [BR:sutk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       FG381_00690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  V-SNARE AP3B1_C_2 Spectrin_Dys-1 BRO1 Motif Other DBs NCBI-ProteinID:  QDA53570 UniProt:  A0ABX5VCY0 LinkDB All DBs Position complement(163625..163915) Genome browser AA seq 96 aa AA seqDB search MDFAQFEKEISDLDGLRQEIRDREARLHDEAVENIQNLIDQLKIKSTELRFADQPSTKKG GVIRPVNPVAPKYRNPESGETGVRPRPHPGLDDAGD NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggatttcgcccagttcgaaaaagaaatcagcgaccttgacggccttcgtcaggaaatt cgcgaccgtgaagcccgccttcacgatgaagccgttgaaaacattcagaacctcattgat cagctgaagatcaagtccaccgagcttcgcttcgccgatcagccttccaccaagaagggc ggcgtgatccgcccggtcaacccggttgccccgaagtaccgcaacccggagtcgggcgag accggggtccggccgcggccgcaccccggtctggatgacgcaggcgattga

DBGET integrated database retrieval system