Sutterella faecalis: FG381_03115 Help Entry FG381_03115       CDS       T06027                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sutk  Sutterella faecalis Pathway sutk01100   Metabolic pathways sutk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sutk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FG381_03115    00074 Mycolic acid biosynthesis     FG381_03115   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FG381_03115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding HSDR_N_2 Motif Other DBs NCBI-ProteinID:  QDA54023 UniProt:  A0ABX5VFD4 LinkDB All DBs Position 782012..782296 Genome browser AA seq 94 aa AA seqDB search MTTFTPQEEKVYQVLSEILVNDFEIPADKIKPEARLYEDFDIDSIDAVDMIVQLKPHLGG RRISPEAFKQVRTLGDVVTVIARVLEKPADGKAD NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgacaaccttcacccctcaggaagaaaaggtctatcaggtcctctccgaaattctcgtg aacgatttcgagattcccgccgacaagatcaagcctgaagcccgtctctacgaagacttc gacatcgattccatcgacgcggtcgacatgatcgtgcagctgaagccccatctcggcggc cgccgcatttccccggaagccttcaagcaggtgcgcaccctgggcgacgtcgtcacggtc atcgcacgcgtccttgaaaagcctgccgacgggaaagccgattaa

DBGET integrated database retrieval system