Suttonella sp. R2A3: L0B52_06415 Help Entry L0B52_06415       CDS       T07824                                  Symbol atpE Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism sutr  Suttonella sp. R2A3 Pathway sutr00190   Oxidative phosphorylation sutr01100   Metabolic pathways Module sutr_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sutr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     L0B52_06415 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sutr00194]     L0B52_06415 (atpE) Photosynthesis proteins [BR:sutr00194]  Photosystem and electron transport system   F-type ATPase [OT]    L0B52_06415 (atpE) SSDB OrthologParalogGFIT Motif Pfam:  ATP-synt_C bPH_10 Motif Other DBs NCBI-ProteinID:  UJF25454 LinkDB All DBs Position complement(1353461..1353733) Genome browser AA seq 90 aa AA seqDB search MLMAIAGIQGPSAIAAGIILGLAALGTGIGFGLLGGKFLESSARQPEMMNPLQGKFFIIA GLLDAVAMIGVVVALIMVFANPLLGSITNL NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgttgatggcgatcgccggtattcaaggcccttcagcgattgctgctggcatcatcctc ggcttagctgctttaggtaccggcattggcttcggtctgctcggtggtaaattcctcgaa agcagcgctcgtcagccagagatgatgaacccattacaaggtaaattcttcattatcgcg ggcttgcttgatgcggttgcgatgatcggggtggttgttgcgttgattatggtatttgct aacccgttgttgggttcaatcaccaatctgtaa

DBGET integrated database retrieval system