Sutterella megalosphaeroides: SUTMEG_16590 Help Entry SUTMEG_16590      CDS       T05697                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sutt  Sutterella megalosphaeroides Pathway sutt01100   Metabolic pathways sutt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sutt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SUTMEG_16590    00074 Mycolic acid biosynthesis     SUTMEG_16590   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SUTMEG_16590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BBF23768 UniProt:  A0A2Z6IEX4 LinkDB All DBs Position 2142839..2143099 Genome browser AA seq 86 aa AA seqDB search MDSTLINEIKALVISSLNLEDTTVEDIDENAPLFGEGLGLDSIDALELGLALKKTYGITL TAESAEAREVFRSVKTLADYVAAHRN NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggattcgaccctcatcaacgaaatcaaagcgctcgtcatttcgagcctcaatctcgaa gacacgaccgtcgaggatatcgacgagaacgcgccccttttcggcgaaggcctcggcctg gacagcatcgacgcgctcgaactcgggctcgccttgaaaaagacctacggcatcacgctt accgccgaaagcgccgaagcccgcgaggtcttccgctccgtcaagaccctggccgactac gtggccgcccaccgcaactga

DBGET integrated database retrieval system