Sutterella megalosphaeroides: SUTMEG_16600 Help Entry SUTMEG_16600      CDS       T05697                                  Symbol acpP_1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sutt  Sutterella megalosphaeroides Pathway sutt01100   Metabolic pathways sutt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sutt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SUTMEG_16600 (acpP_1)    00074 Mycolic acid biosynthesis     SUTMEG_16600 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SUTMEG_16600 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding UL11 Motif Other DBs NCBI-ProteinID:  BBF23769 UniProt:  A0A2Z6IBB7 LinkDB All DBs Position 2143124..2143399 Genome browser AA seq 91 aa AA seqDB search MTELSPSEQRIYEILSEILVNDFEIPAEKIALDARLYEDFDIDSIDAVDMIVQLKPHLGN RRVTPQDFKTVRTLGDVVTVIARVLDRPEEE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccgaactttccccgagcgaacagcgcatttacgaaatcctgagcgagattctcgtc aacgacttcgaaattccggccgaaaaaatcgccctcgacgcccgtctctacgaagacttc gacatcgattcgatcgatgcggtcgacatgatcgtgcagttgaagccccacctcggcaac cgtcgcgtcacgccccaggacttcaagaccgtgcgcacgctcggcgacgtcgtgaccgtg atcgcgcgcgttttggaccgccccgaagaggaataa

DBGET integrated database retrieval system