Sutterella megalosphaeroides: SUTMEG_18900 Help Entry SUTMEG_18900      CDS       T05697                                  Symbol acpP_2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sutt  Sutterella megalosphaeroides Pathway sutt01100   Metabolic pathways sutt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sutt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SUTMEG_18900 (acpP_2)    00074 Mycolic acid biosynthesis     SUTMEG_18900 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SUTMEG_18900 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 MAP Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BBF23999 UniProt:  A0A2Z6IBV8 LinkDB All DBs Position complement(2447803..2448042) Genome browser AA seq 79 aa AA seqDB search MDEIEQKVKKIVAEQLGIKEEDIKNESSFIEDLGADSLTTVEMSLALEDAFGIEIPDTEQ ENLRTVQQAIDFVKAAAAK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacgaaatcgaacagaaggtgaagaagatcgttgccgaacagctcggcatcaaggaa gaagacatcaagaacgaatcttccttcatcgaagacctcggcgccgacagcctcacgacc gttgaaatgtcgctcgccctcgaagatgccttcggcatcgaaatccccgacaccgaacag gaaaacctccgtacggttcagcaggccatcgacttcgtgaaggccgctgccgccaagtaa

DBGET integrated database retrieval system