Staphylococcus aureus 04-02981 (MRSA): SA2981_1261 Help Entry SA2981_1261       CDS       T02070                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism suy  Staphylococcus aureus 04-02981 (MRSA) Pathway suy02024   Quorum sensing suy03018   RNA degradation Brite KEGG Orthology (KO) [BR:suy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     SA2981_1261 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     SA2981_1261 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:suy03019]     SA2981_1261 (hfq)    03036 Chromosome and associated proteins [BR:suy03036]     SA2981_1261 (hfq) Messenger RNA biogenesis [BR:suy03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      SA2981_1261 (hfq) Chromosome and associated proteins [BR:suy03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     SA2981_1261 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 MBG DUF4809 StiP Motif Other DBs NCBI-ProteinID:  ADC37472 LinkDB All DBs Position 1337588..1337821 Genome browser AA seq 77 aa AA seqDB search MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAI STYTVETEGQASTESEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgattgcaaacgaaaacatccaagacaaagcactagagaattttaaagcaaaccaaact gaagtaactgtattctttctaaacggtttccaaatgaaaggtgttattgaagaatacgac aagtatgtcgtaagcttaaattctcaaggcaaacaacacttgatttacaaacatgcgatc agcacttatacagtagaaactgaaggtcaagcatctactgaaagtgaagaataa

DBGET integrated database retrieval system