Sulfurifustis variabilis: SVA_0688 Help Entry SVA_0688          CDS       T05321                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism sva  Sulfurifustis variabilis Brite KEGG Orthology (KO) [BR:sva00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sva03036]     SVA_0688 Chromosome and associated proteins [BR:sva03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     SVA_0688 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  BAU47267 UniProt:  A0A1B4VD27 LinkDB All DBs Position 678912..679187 Genome browser AA seq 91 aa AA seqDB search MSRGALLLALATLATALSVIEIRHENRLLFAELQRLRQERDALNTEWEQLLLEEGAWSQH RRIEQMARKRLDMQTPGREQIVVVHAPAGSP NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgtctagaggcgccctgctgctcgcgctcgccacgctggcgaccgccctgtcggtgatc gagatccgccacgagaaccggttgctctttgccgagctgcagcggctccgccaggagcgg gacgcgctcaacaccgagtgggaacagctgctgctcgaggaaggcgcctggtcgcaacac cggcgcatcgagcagatggcgcgcaagcgtctcgatatgcagacgcccgggcgcgagcag atcgtcgtggttcacgccccggcggggtccccgtga

DBGET integrated database retrieval system