Sulfurifustis variabilis: SVA_1877 Help Entry SVA_1877          CDS       T05321                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sva  Sulfurifustis variabilis Pathway sva01100   Metabolic pathways sva01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sva00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SVA_1877    00074 Mycolic acid biosynthesis     SVA_1877   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SVA_1877 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 DUF5783 DUF1896 Motif Other DBs NCBI-ProteinID:  BAU48431 UniProt:  A0A1B4VBW0 LinkDB All DBs Position complement(1917225..1917464) Genome browser AA seq 79 aa AA seqDB search MSSVEERVKKIVVEQLGVNEGEVTGDASFVDDLGADSLDTVELVMALEEEFDCEIPDEEA EKITTVQQAVDYINAHLSH NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcagtgttgaggagcgcgtcaagaagatcgttgtagagcagctcggtgtgaacgag ggcgaagtcaccggcgacgcttcctttgtcgatgacctgggtgcggactcgctcgacacc gtcgagctcgtgatggcgctggaggaggagttcgactgcgagattcccgacgaggaagcc gagaagatcacgacggtgcagcaggccgtcgattacatcaacgcgcacctcagccactga

DBGET integrated database retrieval system