Streptococcus vestibularis: NCTC12167_00049 Help Entry NCTC12167_00049   CDS       T07051                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism svb  Streptococcus vestibularis Pathway svb01100   Metabolic pathways svb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC12167_00049 (acpP1)    00074 Mycolic acid biosynthesis     NCTC12167_00049 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC12167_00049 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  VED86520 LinkDB All DBs Position 1:35685..35915 Genome browser AA seq 76 aa AA seqDB search MSRVEILQKMQLVIQEQLGREDIVLTEATKLEDLGVDSIELMEFIINLEDEFALEISDNT IDHMDKVSDLLDYLSE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtagagtagaaattcttcagaaaatgcagctcgttattcaagagcaattgggtaga gaggatattgttttaaccgaagctaccaaattagaggacctgggtgtagattcaatagag cttatggaattcattattaatttggaggatgagtttgccctagagatttctgataatacc attgatcatatggataaggtatcagatttgttagactatttgtctgagtaa

DBGET integrated database retrieval system