Streptomyces viridosporus: CP969_25350 Help Entry CP969_25350       CDS       T07568                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism svd  Streptomyces viridosporus Brite KEGG Orthology (KO) [BR:svd00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CP969_25350 Enzymes [BR:svd01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CP969_25350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 GST_N_3 Glrx-like Thioredoxin IU_nuc_hydro Motif Other DBs NCBI-ProteinID:  QEU87641 LinkDB All DBs Position complement(5453433..5453675) Genome browser AA seq 80 aa AA seqDB search MPGTVTMYSTTWCGYCRRLKSQMDREGIAYTEINIEQDPESAAFVEKANGGNQTVPTVLF PDGSTLTNPSLAQVKQKIGA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccgggcactgtgacgatgtacagcaccacgtggtgcggctactgccgtcggctgaag agccagatggaccgcgagggcatcgcgtacaccgagatcaacatcgagcaggacccggag tccgcggcgttcgtggagaaggccaacggcgggaaccagacggttcccacggtcctcttc cccgacggctcgacgctcaccaacccgtcactggcgcaggtgaagcagaagatcggcgcc tga

DBGET integrated database retrieval system