Solanum verrucosum: 125822975 Help Entry 125822975         CDS       T11474                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism sver  Solanum verrucosum Pathway sver03083   Polycomb repressive complex sver04120   Ubiquitin mediated proteolysis sver04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sver00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     125822975    04120 Ubiquitin mediated proteolysis     125822975   09126 Chromosome    03083 Polycomb repressive complex     125822975  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sver04131]     125822975    04121 Ubiquitin system [BR:sver04121]     125822975    03036 Chromosome and associated proteins [BR:sver03036]     125822975 Membrane trafficking [BR:sver04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     125822975 Ubiquitin system [BR:sver04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      125822975    Cul7 complex      125822975 Chromosome and associated proteins [BR:sver03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      125822975   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      125822975 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ DUF7029 Helicase_C_4 Motif Other DBs NCBI-GeneID:  125822975 NCBI-ProteinID:  XP_049358388 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MSLGKLITLKTNDNEEFKLDKTVAVKLEIIKNIVQDVDCTSNVIPLPNIDGKTMTKVVKY WKKHSEEGVTEVQLKNFDQDFLKMSHSELHDVHLAAKYLDDNQLKEVIIQEFLDRIKGKP IEEIREVFGIVNDYTPEEEEEVRRENAWAFE NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtctttaggaaagctcataactcttaagactaacgataatgaggaattcaaactcgac aagactgtagctgtaaagttagaaatcatcaagaacatagtacaagatgttgattgtact tctaatgtcatccccttgcccaatattgatggcaaaacaatgacaaaggtggttaaatat tggaagaaacattcggaggaaggtgttacagaagtccaattaaagaattttgatcaggat ttcttgaagatgagtcactcagaattacatgacgttcacttggctgctaaatatcttgat gataaccaattaaaggaggtaataatccaagaatttcttgataggatcaaagggaaacca atagaggaaatacgtgaagtatttggtatcgtgaatgattatactccagaggaagaggag gaggtccgtagagagaatgcttgggcttttgaatga

DBGET integrated database retrieval system