Sturnus vulgaris (common starling): 106851063 Help Entry 106851063         CDS       T08833                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism svg  Sturnus vulgaris (common starling) Pathway svg04010   MAPK signaling pathway svg04012   ErbB signaling pathway svg04068   FoxO signaling pathway svg04137   Mitophagy - animal svg04140   Autophagy - animal svg04150   mTOR signaling pathway svg04210   Apoptosis svg04218   Cellular senescence svg04370   VEGF signaling pathway svg04371   Apelin signaling pathway svg04540   Gap junction svg04625   C-type lectin receptor signaling pathway svg04810   Regulation of actin cytoskeleton svg04910   Insulin signaling pathway svg04912   GnRH signaling pathway svg04916   Melanogenesis Brite KEGG Orthology (KO) [BR:svg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106851063 (NRAS)    04012 ErbB signaling pathway     106851063 (NRAS)    04370 VEGF signaling pathway     106851063 (NRAS)    04371 Apelin signaling pathway     106851063 (NRAS)    04068 FoxO signaling pathway     106851063 (NRAS)    04150 mTOR signaling pathway     106851063 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106851063 (NRAS)    04137 Mitophagy - animal     106851063 (NRAS)   09143 Cell growth and death    04210 Apoptosis     106851063 (NRAS)    04218 Cellular senescence     106851063 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     106851063 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     106851063 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106851063 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     106851063 (NRAS)    04912 GnRH signaling pathway     106851063 (NRAS)    04916 Melanogenesis     106851063 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:svg04131]     106851063 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:svg04147]     106851063 (NRAS)    04031 GTP-binding proteins [BR:svg04031]     106851063 (NRAS) Membrane trafficking [BR:svg04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     106851063 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     106851063 (NRAS) Exosome [BR:svg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106851063 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    106851063 (NRAS)   Exosomal proteins of breast cancer cells    106851063 (NRAS)   Exosomal proteins of colorectal cancer cells    106851063 (NRAS) GTP-binding proteins [BR:svg04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106851063 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  106851063 NCBI-ProteinID:  XP_014728270 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQG CMGLSCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggcgccggcggcgtgggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccacgatcgaggactcgtac cgcaagcaggtggtgatcgatggtgagacgtgtctgctggacatcctggacacggcgggg caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggattcctctgc gtgttcgccatcaacaacagcaaatccttcgctgacatcaacctctacagagaacagatc aagagagtgaaggactcggatgatgtgcccatggtgctggtggggaacaagtgtgatctg cccacgagaacagtggacacaaaacaggcccaagaattggcaaaaagctatggaatcccc ttcatagagacctctgcaaaaacgagacagggtgtggaagatgctttttacaccctggtg agagagatccggcagtaccggatgaagaaactcaacagcagcgaggatgggaaccagggc tgcatgggactgtcctgccttgtcatgtga

DBGET integrated database retrieval system