Sturnus vulgaris (common starling): 106853206 Help Entry 106853206         CDS       T08833                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism svg  Sturnus vulgaris (common starling) Pathway svg04010   MAPK signaling pathway svg04137   Mitophagy - animal svg04140   Autophagy - animal svg04218   Cellular senescence svg04371   Apelin signaling pathway svg04625   C-type lectin receptor signaling pathway svg04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:svg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106853206 (RRAS2)    04371 Apelin signaling pathway     106853206 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106853206 (RRAS2)    04137 Mitophagy - animal     106853206 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     106853206 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     106853206 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106853206 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:svg04147]     106853206 (RRAS2)    04031 GTP-binding proteins [BR:svg04031]     106853206 (RRAS2) Exosome [BR:svg04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    106853206 (RRAS2)   Exosomal proteins of bladder cancer cells    106853206 (RRAS2) GTP-binding proteins [BR:svg04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106853206 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  106853206 NCBI-ProteinID:  XP_014731801 LinkDB All DBs Position Unknown AA seq 203 aa AA seqDB search MAAGCRDGPGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRA ARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFP MILVGNKADLDHQRQVTQEEGQQLARQLKVVYMEASAKIRLNVDQAFHELVRVIRKFQEQ ECPPSPEPTRKEKDKKGCHCVIF NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atggccgcgggctgcagggacggcccggggcaggagaaataccggctggtggtggtgggc ggcggcggcgtgggcaagtcggctctcaccatccagttcatccagtcctactttgtgact gattatgacccgaccattgaggactcctacaccaagcaatgtgtgatagacgacagagct gcacgcttggacattctggatacagcaggacaagaagaatttggagccatgcgtgagcag tacatgaggacaggggagggttttctgctcgttttctcagtcacagatagaggaagcttt gaagaaatctataaatttcagcggcagattcttagagtgaaagatcgtgatgagtttcca atgattctcgttggtaacaaagcagatctggaccaccaaagacaggtgacacaagaggaa ggccagcagctggcaaggcaacttaaagtagtatacatggaagcctcagcaaaaatcaga ttgaatgtagaccaagcttttcatgaacttgtcagagttataaggaaatttcaggaacaa gagtgccctccttcaccagagccaacacggaaagaaaaagacaagaaaggctgccattgt gtgattttctga

DBGET integrated database retrieval system