Sturnus vulgaris (common starling): 106853309 Help Entry 106853309         CDS       T08833                                  Symbol UBB Name (RefSeq) polyubiquitin-B   KO K04551   ubiquitin B Organism svg  Sturnus vulgaris (common starling) Pathway svg04120   Ubiquitin mediated proteolysis svg04137   Mitophagy - animal svg04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:svg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     106853309 (UBB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106853309 (UBB)    04137 Mitophagy - animal     106853309 (UBB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:svg04121]     106853309 (UBB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:svg04147]     106853309 (UBB) Ubiquitin system [BR:svg04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    106853309 (UBB) Exosome [BR:svg04147]  Exosomal proteins   Exosomal proteins of breast milk    106853309 (UBB)   Exosomal proteins of other body fluids (saliva and urine)    106853309 (UBB)   Exosomal proteins of colorectal cancer cells    106853309 (UBB)   Exosomal proteins of bladder cancer cells    106853309 (UBB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 OTU1_UBXL Dsc3_N UBL_UBAC1 HATPase_c Motif Other DBs NCBI-GeneID:  106853309 NCBI-ProteinID:  XP_014731936 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagaccctgactggcaagaccatcacccttgaggtcgagcccagt gacaccattgaaaatgtcaaggccaagatccaggataaggagggcattcctccagatcag cagaggctgatctttgctggcaagcagctggaagatgggcgcactctctccgattataac atccagaaagaatccaccctgcacctggtgctgcgtctcaggggtgggatgcagattttt gtcaagaccctgactggcaagaccatcaccctggaagtcgagcccagtgacaccatcgag aacgtcaaggccaagatccaggacaaggagggaatccctcctgaccagcagaggctgatc tttgctggcaagcagctggaagatgggcgcaccctgtccgactacaacatccagaaagaa tccaccctgcacctggtgctgcgcctcaggggtggctgttaa

DBGET integrated database retrieval system