Sturnus vulgaris (common starling): 106854707 Help Entry 106854707         CDS       T08833                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism svg  Sturnus vulgaris (common starling) Pathway svg03030   DNA replication svg03410   Base excision repair svg03420   Nucleotide excision repair svg03430   Mismatch repair svg03440   Homologous recombination Brite KEGG Orthology (KO) [BR:svg00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     106854707 (POLD4)    03410 Base excision repair     106854707 (POLD4)    03420 Nucleotide excision repair     106854707 (POLD4)    03430 Mismatch repair     106854707 (POLD4)    03440 Homologous recombination     106854707 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:svg03032]     106854707 (POLD4)    03400 DNA repair and recombination proteins [BR:svg03400]     106854707 (POLD4) DNA replication proteins [BR:svg03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     106854707 (POLD4) DNA repair and recombination proteins [BR:svg03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       106854707 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      106854707 (POLD4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  106854707 NCBI-ProteinID:  XP_014734253 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MSRRAMEQPRRITDSFPRRRGPGRPPGRLKDKNKKDKDKDKVKVKVRDSPRAPSQPPLDP ALLEMLRRFDLSWEYGPCTGITRLQRWERAQELGLSPPGTIRDALLEHRDNPDVTYSLWH EYEL NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgtcgcgcagggccatggagcagccccggcgcatcaccgactccttcccgcggcggcgg ggcccggggcggcccccgggcaggcttaaggacaagaacaagaaggacaaggacaaggac aaagtgaaggtgaaggtgcgggacagtccccgcgccccctcgcagccccccctggacccg gcgctcctggagatgttgcggcgcttcgacctctcctgggaatacggaccctgcaccggg atcacccgcttgcagcgctgggagcgggcacaagagctggggctaagccctcccggcacc atccgtgacgccctcctggagcaccgggacaaccccgatgtcacctacagcctctggcac gagtacgagctctga

DBGET integrated database retrieval system