Sturnus vulgaris (common starling): 106855155 Help Entry 106855155         CDS       T08833                                  Symbol NPS Name (RefSeq) neuropeptide S   KO K25691   neuropeptide S Organism svg  Sturnus vulgaris (common starling) Pathway svg04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:svg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     106855155 (NPS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:svg04052]     106855155 (NPS) Cytokines and neuropeptides [BR:svg04052]  Neuropeptides   GPCR binding    106855155 (NPS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Neuropeptide_S Motif Other DBs NCBI-GeneID:  106855155 NCBI-ProteinID:  XP_014735080 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MTLLCSGFPAAPSMSSNPFYLTCQLLGRWDSCLVLLSRCLSQVGRDEELALAKPLHKRSF RNGVGAGIKKTSTRRAKS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgacattgctgtgctctggtttcccagctgctccttccatgagctccaaccctttctat ttgacgtgccagctgttggggagatgggattcgtgcctggtgctgctgagcaggtgcctg tcccaggtgggcagggacgaggagctggcccttgccaagcctctccacaaaaggtccttc cgcaacggcgtgggagcgggaattaaaaaaacttccacgcgaagggcaaagtcctga

DBGET integrated database retrieval system