Sturnus vulgaris (common starling): 106857810 Help Entry 106857810         CDS       T08833                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism svg  Sturnus vulgaris (common starling) Pathway svg04621   NOD-like receptor signaling pathway svg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:svg00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     106857810  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106857810  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:svg03110]     106857810 Chaperones and folding catalysts [BR:svg03110]  Protein folding catalysts   Protein disulfide isomerase    106857810 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 AhpC-TSA DIM1 OST3_OST6 Glutaredoxin Thioredoxin_7 Thioredoxin_9 Redoxin Motif Other DBs NCBI-GeneID:  106857810 NCBI-ProteinID:  XP_014739587 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKTVGSLVEFEAELKSAGEKLIVVDFSATWCGPCKMIKPFFHSLCEKYGDVVFIEIDVD DAQDVASHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKSLV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagaccgtgggcagcctggttgaatttgaggcagaactgaaatctgctggtgag aagcttatagtagttgatttctctgccacatggtgtggaccatgcaaaatgatcaaaccc tttttccatagtttgtgtgagaagtacggtgatgtggtgttcatagaaattgatgtggat gatgcccaggatgttgcttcacactgtgatgtgaagtgcatgccaacgttccagttctac aagaatggaaagaaggtgcaggagttctccggggccaataaagagaagctggaagagacc attaaaagtctagtctaa

DBGET integrated database retrieval system