Sturnus vulgaris (common starling): 106858358 Help Entry 106858358         CDS       T08833                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism svg  Sturnus vulgaris (common starling) Pathway svg04060   Cytokine-cytokine receptor interaction svg04218   Cellular senescence svg04620   Toll-like receptor signaling pathway svg04621   NOD-like receptor signaling pathway svg04622   RIG-I-like receptor signaling pathway svg05132   Salmonella infection svg05164   Influenza A Brite KEGG Orthology (KO) [BR:svg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106858358  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     106858358  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106858358    04621 NOD-like receptor signaling pathway     106858358    04622 RIG-I-like receptor signaling pathway     106858358  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     106858358   09171 Infectious disease: bacterial    05132 Salmonella infection     106858358  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:svg04052]     106858358    00536 Glycosaminoglycan binding proteins [BR:svg00536]     106858358 Cytokines and neuropeptides [BR:svg04052]  Cytokines   Chemokines    106858358 Glycosaminoglycan binding proteins [BR:svg00536]  Heparan sulfate / Heparin   Chemokines    106858358 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  106858358 NCBI-ProteinID:  XP_014740454 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MNSKLVAVLALFLISAAVSQGRTLARMATELRCQCIATHSRFIPPKSIQDVKLTQSGPHC KNVEVIATLKDGKEVCLEPTAPWVQLIVKAILARAQQNSDSPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacagcaaactcgtggctgtcctggctcttttcctgatctcagcagctgtgtctcaa ggtaggaccttggcaaggatggcaaccgagctcaggtgccagtgcatagccactcattcc aggttcattccccccaaatccattcaagatgtgaagctgacacagagcggcccccactgc aagaacgtcgaagtcatagctactctgaaggatggcaaagaggtgtgcttggagcccact gctccctgggtacagctgattgtaaaggcaattttggccagggctcaacaaaattctgac tctcccctctaa

DBGET integrated database retrieval system