Sturnus vulgaris (common starling): 106859791 Help Entry 106859791         CDS       T08833                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism svg  Sturnus vulgaris (common starling) Pathway svg04010   MAPK signaling pathway svg04068   FoxO signaling pathway svg04081   Hormone signaling svg04114   Oocyte meiosis svg04140   Autophagy - animal svg04150   mTOR signaling pathway svg04810   Regulation of actin cytoskeleton svg04910   Insulin signaling pathway svg04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:svg00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     106859791 (INS)    04150 mTOR signaling pathway     106859791 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     106859791 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106859791 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:svg04052]     106859791 (INS) Cytokines and neuropeptides [BR:svg04052]  Neuropeptides   Unclassified    106859791 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  106859791 NCBI-ProteinID:  XP_014742779 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWIRSLPLLALLALSCPGSSHAAVNQHLCGSHLVEALYLVCGERGFFYQPKARRDVEQ PLVSGPLHGELGELPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatcgctgcctctcctggccctcctcgccctttcctgccccggg agcagccacgctgctgtcaaccagcacctctgtggctcccacctggttgaagctctgtac ctggtgtgcggggagcggggcttcttctaccagcccaaagcccggcgggatgttgagcag cctctagtgagtggtcccttgcatggtgagctgggagagctgcccttccagcaggaggag tttgagaaagtgaagcgaggcatcgtggagcaatgctgccacaacacctgctccctctac cagctggaaaactactgcaattag

DBGET integrated database retrieval system