Sturnus vulgaris (common starling): 106861835 Help Entry 106861835         CDS       T08833                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism svg  Sturnus vulgaris (common starling) Pathway svg04137   Mitophagy - animal svg04140   Autophagy - animal svg04144   Endocytosis svg04145   Phagosome svg04148   Efferocytosis svg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:svg00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106861835 (RAB7A)    04145 Phagosome     106861835 (RAB7A)    04140 Autophagy - animal     106861835 (RAB7A)    04137 Mitophagy - animal     106861835 (RAB7A)    04148 Efferocytosis     106861835 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106861835 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:svg04131]     106861835 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:svg04147]     106861835 (RAB7A)    04031 GTP-binding proteins [BR:svg04031]     106861835 (RAB7A) Membrane trafficking [BR:svg04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     106861835 (RAB7A) Exosome [BR:svg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106861835 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    106861835 (RAB7A)   Exosomal proteins of colorectal cancer cells    106861835 (RAB7A)   Exosomal proteins of bladder cancer cells    106861835 (RAB7A) GTP-binding proteins [BR:svg04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     106861835 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC FLYWCH_N ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  106861835 NCBI-ProteinID:  XP_014745980 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKTDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatccttggagactctggggtggga aagacatcgctcatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggccacg ataggcgcagatttcctgacaaaagaggtgatggtggatgacaggctagtgacaatgcag atatgggatacagcaggccaagaacgatttcagtctctgggagttgccttctacagggga gcagattgctgtgtgctggtatttgatgtcacggctcccaacacattcaaaaccctagac agctggagggacgaattcctcattcaggccagtccaagggatcctgagaattttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctacttcgaaaccagtgccaaggaggccatt aatgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gaactttacaatgaattccccgaacccatcaaactagacaagactgaccgagcgaaggct tctgcagagagctgcagctgctga

DBGET integrated database retrieval system