Sturnus vulgaris (common starling): 106864241 Help Entry 106864241         CDS       T08833                                  Symbol BAX Name (RefSeq) apoptosis regulator BAX   KO K02159   apoptosis regulator BAX Organism svg  Sturnus vulgaris (common starling) Pathway svg04115   p53 signaling pathway svg04141   Protein processing in endoplasmic reticulum svg04210   Apoptosis svg04217   Necroptosis svg05132   Salmonella infection svg05164   Influenza A svg05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:svg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106864241 (BAX)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     106864241 (BAX)    04217 Necroptosis     106864241 (BAX)    04115 p53 signaling pathway     106864241 (BAX)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     106864241 (BAX)    05168 Herpes simplex virus 1 infection     106864241 (BAX)   09171 Infectious disease: bacterial    05132 Salmonella infection     106864241 (BAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:svg03029]     106864241 (BAX)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:svg02000]     106864241 (BAX) Mitochondrial biogenesis [BR:svg03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     106864241 (BAX) Transporters [BR:svg02000]  Other transporters   Pores ion channels [TC:1]    106864241 (BAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 Motif Other DBs NCBI-GeneID:  106864241 NCBI-ProteinID:  XP_014749353 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MSARGASSDQIMQTGAILLRAFVRDRVERCGDPQAVALSVAELGEPQPSSPDTKRLSECL RRIGDELDSNMELQRMIEQVGCDAPKRLFFRVAREMFADGTFNWGRVVALFYFACKLVLK ALCTKVPELVQTILRWTMEYVQENVLAWIQAQGGWEGLLSHFGTPTWQTITIFAAGVLTA SLTIWKMS NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgtctgcacggggggcctcctcggatcagatcatgcagacaggggcgatcctgctgcgg gcgttcgtgcgggaccgcgtggagcgctgcggggacccccaggccgtggccctgagcgtg gccgagctgggcgagccccagcccagcagccccgacaccaaacgcctcagcgagtgcctg cggcgcatcggcgacgagctcgacagcaacatggagctgcagaggatgatcgagcaggtg ggctgtgacgcccccaaaaggctgtttttccgcgtggccagggagatgttcgccgacggc accttcaactggggccgcgtggttgccctgttctactttgcctgcaagctggtgctgaag gctctgtgcaccaaggtcccggagctggtgcagaccatcctgcgctggaccatggagtac gtccaggagaacgtgctggcctggatccaggcccagggcggatgggaagggctcctgtcc catttcgggacccccacctggcagaccatcaccatcttcgccgccggcgtgctcacggcc tcgctgaccatctggaaaatgtcgtag

DBGET integrated database retrieval system