Sturnus vulgaris (common starling): 106864267 Help Entry 106864267         CDS       T08833                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism svg  Sturnus vulgaris (common starling) Pathway svg04810   Regulation of actin cytoskeleton svg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:svg00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     106864267 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106864267 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:svg04131]     106864267 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:svg04812]     106864267 (PFN1)    04147 Exosome [BR:svg04147]     106864267 (PFN1) Membrane trafficking [BR:svg04131]  Others   Actin-binding proteins    Others     106864267 (PFN1) Cytoskeleton proteins [BR:svg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      106864267 (PFN1) Exosome [BR:svg04147]  Exosomal proteins   Proteins found in most exosomes    106864267 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  106864267 NCBI-ProteinID:  XP_014749374 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MSGWAPYVETLLADGTCQDAAIVGYRDTPAVWAAAPGKTFANITPAEVAALVGPERGPLL VQGLTLGGLRCSVIRDSLLVEGEHSMDLRTKGAAGAPTFNITAAITNKTIVLAMGKEGVH GGCVNKKCYEMANHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgagcgggtgggcgccctacgtggagacgctgctggcggacggcacctgccaggatgct gcaatcgtcggctatcgcgacacccccgccgtctgggccgccgcccccggcaagaccttc gccaatatcacgccagcggaggtggcggcactggtgggccccgagcggggcccactgctg gtgcagggactgacgctgggggggctgcgctgctccgtcatccgggactcgctgctggtg gagggggagcacagcatggacctgcgcaccaagggggctgccggagcacccaccttcaac atcacggccgccatcaccaataagaccatcgtgctggccatgggcaaggagggcgtccac ggcggctgcgtcaacaagaaatgttatgagatggccaatcacctgcggcgcagccagtac tga

DBGET integrated database retrieval system