Streptomyces violascens: HWN34_08765 Help Entry HWN34_08765       CDS       T08842                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism svio  Streptomyces violascens Brite KEGG Orthology (KO) [BR:svio00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     HWN34_08765 Enzymes [BR:svio01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      HWN34_08765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 Thioredoxin_2 Thioredoxin Motif Other DBs NCBI-ProteinID:  QLA56645 LinkDB All DBs Position 2069785..2070042 Genome browser AA seq 85 aa AA seqDB search MSGTVTMYSTTWCGYCRRLKSQMDREGIAYEEVNIEHDPESAAFVEKANGGNQTVPTLQI VPKAGGEPVVMTNPSLAQVKQALGA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtcgggcactgtgacgatgtacagcaccacctggtgcggatactgccgtcggctgaag agccagatggaccgcgagggcatcgcgtacgaagaggtcaacatcgagcacgacccggag tcggccgcgttcgtggagaaggcgaacggcgggaaccagaccgtgccgacgctgcagatc gtccccaaggccggcggtgagccggtggtgatgaccaacccgagcctggctcaggtcaag caggcgctcggcgcctga

DBGET integrated database retrieval system