Sander vitreus (walleye): 144516533 Help Entry 144516533         CDS       T11640                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism svit  Sander vitreus (walleye) Pathway svit04137   Mitophagy - animal svit04140   Autophagy - animal svit04142   Lysosome biogenesis svit04144   Endocytosis svit04145   Phagosome svit04148   Efferocytosis svit05132   Salmonella infection Brite KEGG Orthology (KO) [BR:svit00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     144516533 (rab7a)    04145 Phagosome     144516533 (rab7a)    04142 Lysosome biogenesis     144516533 (rab7a)    04140 Autophagy - animal     144516533 (rab7a)    04137 Mitophagy - animal     144516533 (rab7a)    04148 Efferocytosis     144516533 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     144516533 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:svit04131]     144516533 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:svit04147]     144516533 (rab7a)    04031 GTP-binding proteins [BR:svit04031]     144516533 (rab7a) Membrane trafficking [BR:svit04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     144516533 (rab7a) Exosome [BR:svit04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    144516533 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    144516533 (rab7a)   Exosomal proteins of colorectal cancer cells    144516533 (rab7a)   Exosomal proteins of bladder cancer cells    144516533 (rab7a) GTP-binding proteins [BR:svit04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     144516533 (rab7a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 NTPase_1 AAA_7 AAA_22 G-alpha AAA_5 AAA_24 ATPase_2 NB-ARC AAA_14 NACHT SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  144516533 NCBI-ProteinID:  XP_078104022 LinkDB All DBs Position 4:complement(5922402..5927825) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctcaaggaagaaagtactactcaaagtcatcatcctcggagactccggagttggg aagacctcattgatgaaccagtatgtgaataagaagttcagtaaccagtacaaagccaca ataggagcggatttcctgacgaaagaagtcatggtggatgacagacttgtcacaatgcag atttgggacacagcaggtcaggagaggttccagtccttaggcgttgcgttctaccgtgga gcagactgctgcgtcctggtgtttgatgtgacagcacccaacaccttcaagactctagac agctggagagacgagttcttgatccaggccagccctcgagacccagagaatttccccttt gttgtgctgggcaataagatcgacctggagaacagacaggtaacgaccaagcgagcacag gcttggtgtcaaagtaagaacaacatcccgtatttcgaaaccagtgccaaggaggcaatc aatgtggagcaggccttccagactattgcacgcaatgcccttaaacaggagaccgaagtg gagttgtacaacgagttccctgagccaataaagctggacaggaacgagcgagccaagccg tcagcggagacctgcagctgctga

DBGET integrated database retrieval system