Sander vitreus (walleye): 144527528 Help Entry 144527528         CDS       T11640                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism svit  Sander vitreus (walleye) Pathway svit04145   Phagocytosis svit04517   IgSF CAM signaling svit04814   Motor proteins svit05132   Salmonella infection Brite KEGG Orthology (KO) [BR:svit00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     144527528 (dynll2b)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     144527528 (dynll2b)   09142 Cell motility    04814 Motor proteins     144527528 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     144527528 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:svit03037]     144527528 (dynll2b)    04812 Cytoskeleton proteins [BR:svit04812]     144527528 (dynll2b) Cilium and associated proteins [BR:svit03037]  Motile cilia and associated proteins   Dynein arm    144527528 (dynll2b) Cytoskeleton proteins [BR:svit04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      144527528 (dynll2b) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light RP853 Nop Motif Other DBs NCBI-GeneID:  144527528 NCBI-ProteinID:  XP_078121769 LinkDB All DBs Position 13:16199407..16201208 Genome browser AA seq 89 aa AA seqDB search MSDKKAVIKNADMSDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaagaaggcagtgataaagaatgcagacatgtctgatgaaatgcagcaggat gcagtggactgtgccatgcaggctatggaaaagtacaacattgagaaggatattgctgcc tatgtcaaaaaggagtttgacaagaagtacaaccccacatggcattgcattgttgggagg aattttgggagctacgtgacgcacgagacgaagcatttcatctacttctacctgggccaa gtggccattctactgttcaagtcgggctga

DBGET integrated database retrieval system