Sander vitreus (walleye): 144536795 Help Entry 144536795         CDS       T11640                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism svit  Sander vitreus (walleye) Pathway svit04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:svit00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     144536795  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:svit04121]     144536795    03400 DNA repair and recombination proteins [BR:svit03400]     144536795 Ubiquitin system [BR:svit04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      144536795    Cul5 complex      144536795 DNA repair and recombination proteins [BR:svit03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      144536795 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD LED_rpt Motif Other DBs NCBI-GeneID:  144536795 NCBI-ProteinID:  XP_078136201 LinkDB All DBs Position 21:13847160..13851277 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQSLEDSKTLGDC GFTNQTARPQAPATIGLAFRINDDMFEQLHIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcacaagaccacaatcttcacagatgccaaggag tctaccactgtgtatgagctgaagcgtattgttgaaggaatccttaagagaccacctgaa gaccagaggctgtataaagatgaccagtcactagaggacagcaaaactcttggtgactgt ggatttaccaaccagactgccagacctcaagccccagctacaattggtctggccttccgt attaatgatgacatgttcgaacagctgcacatcgaggccttctccagccccccagaactc cctgatgtgatgaagcctcaggactccggtagcactgccaacgaacaggcggtccagtga

DBGET integrated database retrieval system