Subdoligranulum variabile: NQ490_01335 Help Entry NQ490_01335       CDS       T08454                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism svj  Subdoligranulum variabile Pathway svj01100   Metabolic pathways svj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NQ490_01335 (acpP)    00074 Mycolic acid biosynthesis     NQ490_01335 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NQ490_01335 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  UWP68522 LinkDB All DBs Position complement(278037..278264) Genome browser AA seq 75 aa AA seqDB search MTFEELKNVIVETLNADADAVTMEASLADDLNADSLDAVELNMALEEKFGTAIPDEELGN MKTVGDIFNYLTKNA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacttttgaagaactgaagaatgtgatcgttgagaccctgaatgccgatgccgatgct gttacgatggaagccagcctggcagatgacctgaatgccgacagcctggatgcagtggaa ctgaatatggcgctggaggaaaaattcggcaccgccattccggatgaggagctgggcaac atgaagactgtgggcgacatcttcaactacctgaccaagaacgcctga

DBGET integrated database retrieval system