KEGG   Streptomyces violaceusniger: Strvi_5780
Entry
Strvi_5780        CDS       T01602                                 
Name
(GenBank) cytochrome P450
  KO
K22997  cyclooctat-9-en-7-ol 5-monooxygenase [EC:1.14.99.61]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00997  Biosynthesis of various other secondary metabolites
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
Module
svl_M00921  Cyclooctatin biosynthesis, dimethylallyl-PP + isopentenyl-PP => cyclooctatin
Brite
KEGG Orthology (KO) [BR:svl00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various other secondary metabolites
    Strvi_5780
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.61  cyclooctat-9-en-7-ol 5-monooxygenase
     Strvi_5780
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AEM85290
UniProt: G2P5W2
LinkDB
Position
6602763..6604124
AA seq 453 aa
MTSTKSSAQPERSWTTGTAPGSVPLLGHTLALWRRPLQFLASLPAHGDLVEVRLGPSRAY
LACHPELVRQVLLNPRVFDKGGVFDKARQLLGNSLSVSRGEDHRTQRRMIQPAFHTPKIA
DYTAAVADDTRAAIGSWEPGRTLDLSDTMHALLMRVAARTLFSTGIDEATIDEARHCLRI
VSHGIYKRTMAPLGIMEKLPTPGNRRYDRANARLRQIVDEMIRDRRRSGADHGDLLSTLL
RAEHPETGEGLDDGEVLDQVVTFLVAGSETTASTLAFVFHLLGAHPEVEKRVHAEIDEAL
KGRSPTFEDLPSLEYTRGVITESLRLYPPSWMAMRVTAAETDLGGRTIPAGTMILYSAQA
LHHNPGLFPDPERFDPERWFPDRAKDVPRGALLPFGAGSHKCIGDVLALTETALIVATIA
SRWRLRPVPGTTLRPEPKATLEPGPLPMVCEPR
NT seq 1362 nt   +upstreamnt  +downstreamnt
gtgacttccacgaagagctccgcacagccggagcgctcctggaccaccggcacggcgccc
ggctcggtgccgctgctggggcacacgctggcgctctggcgccgtccgctgcagttcctg
gcctccctgcccgcccacggcgatctggtggaggtcaggctggggcccagccgcgcctat
ctggcctgccatcccgaactggtccgccaggtgctgctcaatccccgtgtgttcgacaag
ggcggggtcttcgacaaggcgcggcagctactcgggaacagcctctcggtctcccggggc
gaggatcaccgcactcagcggcggatgatccagcccgcgttccacaccccgaagatcgcc
gactacaccgccgcggtcgccgacgacacccgcgccgcgatcggctcctgggagccgggg
cggaccctggacctcagcgacaccatgcacgccctgctgatgcgggtcgccgcgcggacg
ctgttctccaccgggatcgacgaggcgacgatcgacgaggcgcgccactgtctgcgcatc
gtctcgcacggcatctacaaacgcaccatggcgcctttggggatcatggagaagctcccc
accccgggcaaccgccgctatgaccgggccaacgcccggctgcggcagatcgtggacgag
atgatccgcgaccgccggcgctccggcgccgaccacggcgatctgctctccacgctgctg
cgcgcagaacaccccgagaccggcgaggggctggacgacggcgaggtcctcgaccaggtg
gtcaccttcctggtcgccgggagcgagaccaccgcctcgacgctcgccttcgtcttccat
ctcctgggcgcgcacccggaggtggagaagcgggtgcacgccgagatcgacgaggccctg
aagggccgttcgcccaccttcgaggacctgccgtccctggagtacacccggggggtcatc
accgagtcgctgcggctgtatccgccgtcctggatggcgatgcgggtcacggcggccgag
acggacctcggtggccgcaccatcccggcgggcacgatgatcctgtacagcgcccaggca
ctgcaccacaaccccggactgttccccgaccccgagcggttcgacccggagcgctggttc
cccgaccgtgccaaggacgtgccgcgcggggcgctgctcccgttcggcgcgggcagccac
aagtgcatcggggacgtcctggcgctgaccgagaccgccctcatcgtggcgacgatcgcg
agccggtggcgtcttcgcccggtgcccgggacgacgttgcgccccgagccgaaggcgacg
ctcgaacccggcccgctgccgatggtgtgcgagccgcgctga

DBGET integrated database retrieval system