Streptomyces violaceusniger: Strvi_5875 Help Entry Strvi_5875        CDS       T01602                                  Name (GenBank) hypothetical protein   KO K16025   methoxymalonate biosynthesis acyl carrier protein Organism svl  Streptomyces violaceusniger Pathway svl01051   Biosynthesis of ansamycins svl01052   Type I polyketide structures Brite KEGG Orthology (KO) [BR:svl00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01052 Type I polyketide structures     Strvi_5875    01051 Biosynthesis of ansamycins     Strvi_5875  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:svl01008]     Strvi_5875 Polyketide biosynthesis proteins [BR:svl01008]  Polyketide tailoring proteins   Others    Strvi_5875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AEM85383 UniProt:  G2PG77 LinkDB All DBs Position complement(6743386..6743661) Genome browser AA seq 91 aa AA seqDB search MTISSEPGSHTAETVAQEVQQFLEQRTKQTWDPDTDLFSTGAVSSMFAMELVVHLESTFD VVITGPDLALDNFRTVNAMTAMVLRLRGAQP NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgaccatctcatccgagccgggcagccacaccgccgagacggtggcgcaggaggtgcag cagttcctcgaacagcgcaccaagcagacctgggacccggacaccgacctgttcagcacc ggcgccgtgtcctcgatgttcgccatggagctggtcgtgcacctggagtcgaccttcgac gtggtgatcaccggccccgacctggcgctggacaacttccgcacggtcaacgcgatgacc gcgatggtcctgcgactgcgcggggcacagccgtga

DBGET integrated database retrieval system