Streptomyces violaceusniger: Strvi_7543 Help Entry Strvi_7543        CDS       T01602                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism svl  Streptomyces violaceusniger Pathway svl00998   Biosynthesis of various antibiotics svl01100   Metabolic pathways svl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Strvi_7543    00074 Mycolic acid biosynthesis     Strvi_7543   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Strvi_7543 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF2969 Motif Other DBs NCBI-ProteinID:  AEM86893 UniProt:  G2P705 LinkDB All DBs Position 8601415..8601663 Genome browser AA seq 82 aa AA seqDB search MAATQEEILEGLAEIVNEIAGIPTEDVLLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDAVEYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcctcgaaggtctcgccgagatcgtcaacgagatcgcc ggtatcccgaccgaggacgtcctgctggacaagtccttcaccgacgatctggacgtcgac tcgctgtccatggtcgaggtggtcgtcgccgccgaggagcgcttcgacgtgaagatcccg gacgacgacgtcaagaacctcaagaccgtcggcgacgccgtcgagtacatcctcaagcac cagggctga

DBGET integrated database retrieval system