Shewanella vesiculosa: KDH10_000535 Help Entry KDH10_000535      CDS       T08322                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism svm  Shewanella vesiculosa Pathway svm01100   Metabolic pathways svm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KDH10_000535 (acpP)    00074 Mycolic acid biosynthesis     KDH10_000535 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KDH10_000535 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB EutQ DUF1896 Motif Other DBs NCBI-ProteinID:  UJL43266 LinkDB All DBs Position 615395..615628 Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIIEQLGVKEEDVKSAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVSKNQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgtgtaaagaaaatcatcatcgagcaacttggcgttaaagaa gaagacgttaaatcagctgcttcttttgtagacgatttaggcgctgattctctagacact gttgaattggttatggctctagaagaagagtttgataccgagatccctgacgaagaagct gaaaagatcactactgttcaagcagcgatcgattacgtttctaagaatcagtaa

DBGET integrated database retrieval system