Shewanella vesiculosa: KDH10_002681 Help Entry KDH10_002681      CDS       T08322                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism svm  Shewanella vesiculosa Pathway svm01100   Metabolic pathways svm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KDH10_002681    00074 Mycolic acid biosynthesis     KDH10_002681   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KDH10_002681 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UJL41674 LinkDB All DBs Position 3133591..3133845 Genome browser AA seq 84 aa AA seqDB search MNLHNQIKQLIIDCLDLEDVTVDDIETDAALFGDGLGLDSIDALELGLAIKKEFDVKIEA NSDATKAHFFSVASLASFIESQRV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaacttacacaaccaaataaaacaactgatcattgattgcttagatttagaagatgtc actgtcgatgatatcgaaactgacgcggccttatttggtgacggtctggggttagactcg atcgatgcgctagagttgggcttggcgattaagaaagagtttgatgtcaaaattgaagcc aattcagatgcaactaaagcacactttttcagtgttgctagcttagctagctttattgaa tctcaacgtgtttag

DBGET integrated database retrieval system