Streptomyces vinaceus: CP980_02575 Help Entry CP980_02575       CDS       T06865                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism svn  Streptomyces vinaceus Pathway svn00998   Biosynthesis of various antibiotics svn01100   Metabolic pathways svn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP980_02575    00074 Mycolic acid biosynthesis     CP980_02575   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP980_02575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QEV44104 UniProt:  A0A5J6J5F3 LinkDB All DBs Position complement(536361..536624) Genome browser AA seq 87 aa AA seqDB search MRDAVTTSAPESVLDVISELLVEKFEVPSEEVRGSAPMSDLLIDSLMIVEMAIAVHETLG VKVDEEELRAATLDEFAASVDARLTDR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagagatgccgtgaccacttccgcaccggaatccgtcctcgacgtgatcagcgaactg ctcgtcgaaaagttcgaagtcccctccgaagaggtacgggggagtgcgccgatgagcgac ctgctgatcgattcgctcatgatcgtcgaaatggccatcgccgttcacgaaacgctcggg gtcaaggtcgacgaggaggagctgcgcgccgccaccctcgacgagttcgccgcctccgtc gacgcacggctgacggaccgttga

DBGET integrated database retrieval system