Streptomyces vinaceus: CP980_11715 Help Entry CP980_11715       CDS       T06865                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism svn  Streptomyces vinaceus Brite KEGG Orthology (KO) [BR:svn00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CP980_11715 Enzymes [BR:svn01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CP980_11715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like Thioredoxin GST_N_3 GST_N_2 Motif Other DBs NCBI-ProteinID:  QEV45657 UniProt:  A0A5J6J369 LinkDB All DBs Position 2668943..2669203 Genome browser AA seq 86 aa AA seqDB search MQDTGSVTMYSTTWCGYCRRLKTQLDREGIAYNEINIELDPESAAFVEKANGGNQTVPTV LVKSAAGAESVMTNPSLAQVKQALAV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcaggacacgggttccgtcacgatgtacagcacgacctggtgcggctactgccgccgg ctgaagacccagctggaccgggaaggcatcgcgtacaacgagatcaacatcgagctggac ccggagtccgcggcgttcgtcgagaaggcgaacggcggcaaccagacggtcccgaccgtg ctcgtgaagtccgccgccggcgccgagtcggtcatgacgaacccgagcctggcccaggtc aagcaggccctggccgtctga

DBGET integrated database retrieval system