Streptomyces vinaceus: CP980_34975 Help Entry CP980_34975       CDS       T06865                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism svn  Streptomyces vinaceus Brite KEGG Orthology (KO) [BR:svn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:svn03032]     CP980_34975    03036 Chromosome and associated proteins [BR:svn03036]     CP980_34975    03400 DNA repair and recombination proteins [BR:svn03400]     CP980_34975 DNA replication proteins [BR:svn03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CP980_34975 Chromosome and associated proteins [BR:svn03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CP980_34975 DNA repair and recombination proteins [BR:svn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CP980_34975 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QEV49531 UniProt:  A0A5J6JI84 LinkDB All DBs Position 7667370..7667648 Genome browser AA seq 92 aa AA seqDB search MNKQELIDLVSEETEASKASVNKVLDAALHTIKSAVAEGDSVQLIGFGSFSVGERAARMG RNPKTGEPVEIAAGRTVRFMAGKAFKDSVNAK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaacaggaactgatcgatctcgtctcggaggagaccgaggcctccaaagcgtct gtgaacaaggtcttggacgccgcgctgcacaccatcaaaagcgcggttgcggagggtgac tcggtgcagttgatcgggttcggctcgttctcggtgggggagcgagctgcgcgtatgggc cggaacccgaagactggcgagcccgttgagatcgctgcgggcaggaccgtgaggttcatg gctggcaaggcgttcaaggactcggtcaacgcaaagtag

DBGET integrated database retrieval system