Stratiformator vulcanicus: Pan189_32680 Help Entry Pan189_32680      CDS       T09804                                  Symbol acpP_3 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism svp  Stratiformator vulcanicus Pathway svp01100   Metabolic pathways svp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pan189_32680 (acpP_3)    00074 Mycolic acid biosynthesis     Pan189_32680 (acpP_3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pan189_32680 (acpP_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Guanylate_cyc ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QDT38869 UniProt:  A0A517R4Q4 LinkDB All DBs Position 3984237..3984500 Genome browser AA seq 87 aa AA seqDB search MEATRVSDENLEEGVIAIVSDQLNVPVEEITKESSFIDDLKADSLDLVELVMEFEDRFEV TIPDEDYEKIKTVGDAISYIKEKSGNA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggaggccacaagagtgtctgacgaaaatctggaagaaggcgtcattgcgatcgtcagc gatcaactcaacgtccccgttgaagagatcacgaaagagagcagtttcatcgatgatctc aaagccgactcgctcgatctcgttgagctggtgatggagttcgaagaccgtttcgaagtc accatcccggacgaagactacgagaagatcaaaactgtcggcgacgcgatctcgtacatc aaggaaaagagcgggaatgcgtag

DBGET integrated database retrieval system