Streptomyces viridifaciens: CP971_23205 Help Entry CP971_23205       CDS       T06960                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism svr  Streptomyces viridifaciens Pathway svr00998   Biosynthesis of various antibiotics svr01100   Metabolic pathways svr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP971_23205    00074 Mycolic acid biosynthesis     CP971_23205   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP971_23205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF2969 Motif Other DBs NCBI-ProteinID:  QEV01757 LinkDB All DBs Position complement(5252209..5252454) Genome browser AA seq 81 aa AA seqDB search MATQNEVQEGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPD DEVKNLKTVGDAVNYILTNAA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctacgcagaacgaggtccaggaaggtctcgccgagatcgtcaacgagatcgccggc atcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgactcg ctgtccatggtcgaggtcgtcgtggccgccgaggagcgcttcgacgtcaagatcccggac gacgaggtcaagaacctgaagaccgtcggcgacgcggtgaactacatcctcaccaacgcc gcctga

DBGET integrated database retrieval system