KEGG   Streptomyces viridifaciens: CP971_23960
Entry
CP971_23960       CDS       T06960                                 
Name
(GenBank) hypothetical protein
  KO
K14256  anhydrotetracycline 6-monooxygenase / 5a,11a-dehydrotetracycline 5-monooxygenase [EC:1.14.13.38 1.14.13.234]
Organism
svr  Streptomyces viridifaciens
Pathway
svr00253  Tetracycline biosynthesis
svr01057  Biosynthesis of type II polyketide products
svr01100  Metabolic pathways
svr01110  Biosynthesis of secondary metabolites
Module
svr_M00780  Tetracycline/oxytetracycline biosynthesis, pretetramide => tetracycline/oxytetracycline
svr_M00823  Chlortetracycline biosynthesis, pretetramide => chlortetracycline
Brite
KEGG Orthology (KO) [BR:svr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    CP971_23960
   00253 Tetracycline biosynthesis
    CP971_23960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:svr01008]
    CP971_23960
Enzymes [BR:svr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.38  anhydrotetracycline 6-monooxygenase
     CP971_23960
    1.14.13.234  5a,11a-dehydrotetracycline 5-monooxygenase
     CP971_23960
Polyketide biosynthesis proteins [BR:svr01008]
 Polyketide tailoring proteins
  Oxygenase
   CP971_23960
SSDB
Motif
Pfam: FAD_binding_3 DAO DUF1059 Pyr_redox
Other DBs
NCBI-ProteinID: QEV01885
LinkDB
Position
complement(5412562..5413989)
AA seq 475 aa
MLACELALGGARAVVVERRREPEKHSKAMGMQGRTVELLELRGLLDRFKEGAGVLQGGNF
ASLGVPMRFEEFDTRHPYVLLVPQLRTEELLAERARELGVRIVRGSGVTGFAQDADGVTV
ETDTGLLRARYLVGCDGGGSTVRKAAGIGFTGQDPHMYALIGDMRFSGDLPRGEGLGPMR
PVGLVNPAKRSWFGAFQHQPGVYRATVAWFDRPFADRRAPVTEEEMRAALVEHTGSDHGM
HDVTWLSRLTDVSRLADSYRLGRVLLAGDAAHIHLPAGGQGLNLGFQDAVNLGWKLAAVV
RGHGTEELLDSYGRERRPIADGVVRNTRTQAVLIDPDPRYEALRQTFRDLMALPDTNRHI
AGMLSGFDVAYGGGDHPLVGRRMPDAELITADGPRRISDCFAGARGLLLLPGQGPTASPL
AAWADRVDTLTVKSGGPDPDTAHLVRPDGYVAWAGEAARTEELHHAATTWFGAAA
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgctcgcctgcgaactggccctgggcggagcccgggcggtggtggtggaacggcgccgc
gagccggagaagcactccaaggccatgggcatgcagggccgcaccgtggaactgctcgaa
ctgcgcgggctgctcgaccgcttcaaggagggcgcgggcgtgctgcagggcggcaacttc
gccagcctgggcgtgccgatgcgcttcgaggagttcgacacccgccacccgtacgtgctg
ctggtgccccaactgcgcaccgaggagctgctcgccgaacgggcccgcgaactgggcgtg
cggatcgtgcgcggctcgggcgtcaccggcttcgcccaggacgccgacggggtcaccgtc
gagacggacacgggcctgcttcgggcacggtacctggtcggctgcgacggcggcggcagc
accgtccgcaaggccgccggcatcggcttcaccggacaggacccgcacatgtacgccctc
atcggcgacatgcgcttcagcggcgacctgccgcgcggcgagggcctcggcccaatgcgg
ccggtgggcctggtcaaccccgccaagcggtcctggttcggcgccttccagcaccagccg
ggcgtctaccgggccaccgtcgcctggttcgaccggcccttcgccgaccgccgcgccccg
gtcaccgaggaggagatgcgcgccgcactggtcgagcacaccggcagtgaccacgggatg
cacgacgtcacctggctgtcccgcctcaccgacgtctcccggctggccgactcctaccgg
ctgggccgggtgctgctggccggcgacgccgcgcacatccacctgccggccggcggccag
gggctcaacctgggcttccaggacgccgtcaacctcggctggaagctggccgccgtggtc
cgcggccacggcaccgaggagctgctggacagctacggccgcgagcgtcgcccgatcgcc
gacggcgtggtgcgcaacacccgcacccaggccgtcctgatcgacccggacccgcggtac
gaggcactgcgccagaccttccgcgacctgatggcgctgcccgacaccaaccgccacatc
gccggcatgctctccggcttcgacgtcgcctacggcggcggcgaccaccctctggtcggc
cgccggatgccggacgccgagctgatcaccgcggacgggccgcggaggatcagcgattgc
ttcgccggggcccgcggtctgctgctgctccccggacagggcccgaccgcctcgccgctg
gccgcctgggcggaccgcgtggacaccctgaccgtcaagtcgggcggcccggacccggac
accgcccacctcgtccgcccggacggctacgtggcctgggccggcgaagcggcccgcacc
gaggaactgcaccacgccgcgaccacctggttcggcgcggcggcctga

DBGET integrated database retrieval system