Streptomyces viridifaciens: CP971_30025 Help Entry CP971_30025       CDS       T06960                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism svr  Streptomyces viridifaciens Pathway svr00998   Biosynthesis of various antibiotics svr01100   Metabolic pathways svr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP971_30025    00074 Mycolic acid biosynthesis     CP971_30025   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP971_30025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEV04321 LinkDB All DBs Position complement(6789379..6789633) Genome browser AA seq 84 aa AA seqDB search MLTVVLDDCGLGDAEVTMQTRFTEDLGLESIDLVTLAGQLRERWGDRINFAEFVAGMELD EIIGLTVGRLVEYVVDRLQPGERA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgctgaccgtggtgctcgacgattgcggcctgggcgacgccgaggtcaccatgcagacg cggttcaccgaggacctcggcctggagagcatcgacctggtcacactggccggacagctg cgggagcgctggggcgaccggatcaacttcgccgagttcgtcgcgggcatggaactcgac gagatcatcggcctgaccgtcggccgcctggtcgagtacgtggtcgaccgactccagccc ggagaacgggcctga

DBGET integrated database retrieval system