Setaria viridis (green foxtail): 117833257 Help Entry 117833257         CDS       T07951                                  Name (RefSeq) uncharacterized protein   KO K09481   protein transport protein SEC61 subunit beta Organism svs  Setaria viridis (green foxtail) Pathway svs03060   Protein export svs04141   Protein processing in endoplasmic reticulum svs04145   Phagosome Brite KEGG Orthology (KO) [BR:svs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     117833257    04141 Protein processing in endoplasmic reticulum     117833257  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     117833257  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:svs04131]     117833257   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:svs02044]     117833257 Membrane trafficking [BR:svs04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     117833257 Secretion system [BR:svs02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    117833257 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  117833257 NCBI-ProteinID:  XP_034568577 LinkDB All DBs Position 8:complement(270688..271480) Genome browser AA seq 107 aa AA seqDB search MARSSSQSQSSVGGAGAGARPATVGPRGTAAAAAGMRRRRATASTGGGGFSGGGGSNMLR FYTDEAPGLRLSPTMVLVMSLCFIGFVTALHVFGKLYRSRTAAAASA NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccgctcctcctcccagtcccagtcctccgtcggcggcgccggcgccggagcccgc ccggccaccgtcggcccgcgcggcacggccgcagccgccgccggcatgcgccgccgccgc gccaccgccagcaccgggggagggggcttctccggcggcggcggcagcaacatgctgcgc ttctacaccgacgaggccccgggcctgcgcctctcgcccaccatggtcctcgtcatgtcc ctctgcttcatcgggttcgtcaccgccctccacgtcttcggcaagctctaccgctcccgc accgccgcagctgcatccgcctga

DBGET integrated database retrieval system