Setaria viridis (green foxtail): 117845664 Help Entry 117845664         CDS       T07951                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism svs  Setaria viridis (green foxtail) Pathway svs04145   Phagocytosis svs04517   IgSF CAM signaling svs04814   Motor proteins Brite KEGG Orthology (KO) [BR:svs00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     117845664  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     117845664   09142 Cell motility    04814 Motor proteins     117845664  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:svs03037]     117845664    04812 Cytoskeleton proteins [BR:svs04812]     117845664 Cilium and associated proteins [BR:svs03037]  Motile cilia and associated proteins   Dynein arm    117845664 Cytoskeleton proteins [BR:svs04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      117845664 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  117845664 NCBI-ProteinID:  XP_034582619 LinkDB All DBs Position 2:41866827..41867853 Genome browser AA seq 115 aa AA seqDB search MLESQAVIGDTDMLQAMQQDALRLAGKALDDFEAVDSTEIARFIKKEFDRSYGPGWQCIV GTDFGSFVTHHSGCFIYFGIGNLAILLFNGGAGGAPQGGTAEQARLTALKAAVEA NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgctggagagccaggcggtgatcggggacacggacatgctgcaggcgatgcagcaggac gcgctgcggctggccgggaaggcgctggacgacttcgaggccgtcgactccaccgagatc gcccggttcatcaagaaggagttcgaccggtcgtacgggcccggatggcagtgcatcgtg ggcaccgacttcgggtccttcgtgacgcaccactccggctgcttcatctacttcggcatc ggcaacctggccatcctgctgttcaatggcggcgccggcggcgctcctcagggtggcacg gcggagcaggcgcggctcacggcgctgaaggctgctgtcgaggcgtga

DBGET integrated database retrieval system