Setaria viridis (green foxtail): 117845979 Help Entry 117845979         CDS       T07951                                  Name (RefSeq) 10 kDa chaperonin, mitochondrial   KO K04078   chaperonin GroES Organism svs  Setaria viridis (green foxtail) Brite KEGG Orthology (KO) [BR:svs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:svs03110]     117845979    03029 Mitochondrial biogenesis [BR:svs03029]     117845979 Chaperones and folding catalysts [BR:svs03110]  Heat shock proteins   HSP10    117845979 Mitochondrial biogenesis [BR:svs03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     117845979 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-GeneID:  117845979 NCBI-ProteinID:  XP_034582967 LinkDB All DBs Position 2:45458929..45460769 Genome browser AA seq 98 aa AA seqDB search MAKRLLPSLNRVLVEKLVQPKKTAGGILLPETSKQLNAAKVVAVGPGERDREGKLIPVAL KEGDTVLLPEYGGTEVKLAADKEYLLFREPDILGTLVD NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggcgaagaggctgctcccgtcgctgaaccgggtgctggtggagaagctggtgcagccc aagaagacagccggcggcatcctcctcccggagacgtccaagcagctgaacgctgccaaa gtggtggctgttggccctggcgagcgtgacagggaaggcaagctgatccctgttgctctg aaggaaggtgacactgttctcctgcctgagtatggtggaactgaagtcaagcttgctgct gataaagagtacctcctcttcagagagcctgacatcttgggtacacttgtggactga

DBGET integrated database retrieval system