Setaria viridis (green foxtail): 117849135 Help Entry 117849135         CDS       T07951                                  Name (RefSeq) SKP1-like protein 5   KO K03094   S-phase kinase-associated protein 1 Organism svs  Setaria viridis (green foxtail) Pathway svs03083   Polycomb repressive complex svs04120   Ubiquitin mediated proteolysis svs04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:svs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     117849135    04120 Ubiquitin mediated proteolysis     117849135   09126 Chromosome    03083 Polycomb repressive complex     117849135  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:svs04131]     117849135    04121 Ubiquitin system [BR:svs04121]     117849135    03036 Chromosome and associated proteins [BR:svs03036]     117849135 Membrane trafficking [BR:svs04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     117849135 Ubiquitin system [BR:svs04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      117849135    Cul7 complex      117849135 Chromosome and associated proteins [BR:svs03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      117849135   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      117849135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Motif Other DBs NCBI-GeneID:  117849135 NCBI-ProteinID:  XP_034586614 LinkDB All DBs Position 3:complement(21026723..21027016) Genome browser AA seq 97 aa AA seqDB search MSRVLQYLNKKHSGGGAFAAVEVKEFEKAFFEKMTKEALFDVILAANYLHAEKLLDAAMV CVADRIMGKTVPELREYFGIEIDFTPEEEEEIRKENS NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtccagggtgctccagtacctcaacaagaagcatagcggcggcggcgcgtttgcggcc gtggaggttaaggagttcgagaaggccttcttcgagaagatgacgaaggaggcgctgttc gacgtgatcctggcggccaactacctccatgcggagaagctgctggacgcggcgatggtg tgcgtcgcggacaggattatgggaaagacggtgccggagcttcgggagtacttcggcatc gagatcgacttcacccccgaggaggaggaagagatcaggaaggagaactcctag

DBGET integrated database retrieval system