Setaria viridis (green foxtail): 117857397 Help Entry 117857397         CDS       T07951                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism svs  Setaria viridis (green foxtail) Pathway svs04145   Phagocytosis svs04517   IgSF CAM signaling svs04814   Motor proteins Brite KEGG Orthology (KO) [BR:svs00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     117857397  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     117857397   09142 Cell motility    04814 Motor proteins     117857397  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:svs03037]     117857397    04812 Cytoskeleton proteins [BR:svs04812]     117857397 Cilium and associated proteins [BR:svs03037]  Motile cilia and associated proteins   Dynein arm    117857397 Cytoskeleton proteins [BR:svs04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      117857397 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Vesi_VP2 Motif Other DBs NCBI-GeneID:  117857397 NCBI-ProteinID:  XP_034595936 LinkDB All DBs Position 5:complement(4430407..4434240) Genome browser AA seq 124 aa AA seqDB search MSDEARRGAGGAAQAALRASSEDRKPVGAGSPPPAAAGHKIQLKSADMKEEMRQEAFEIA RIAFEKHTMEKDIAEYIKKEFDKNHGPTWHCIVGRNFGSYVTHETNYFVYFYIDSKAVLL FKSG NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgtccgacgaggccaggcgcggggccgggggcgccgcgcaggcggcgctccgggcctcc tccgaggaccgcaagccggtgggcgcggggtccccgccgccggccgcggcggggcacaag atccagctcaagagcgccgatatgaaggaggagatgcggcaggaggccttcgaaatcgcc cgcatcgcgttcgagaagcacaccatggagaaggacatcgcggagtacatcaagaaggag ttcgacaagaaccacggcccaacctggcactgcatcgtcggccgcaacttcggttcgtat gtaacgcatgagacaaactactttgtatacttctacatcgattccaaagccgtcttgcta ttcaagtctgggtga

DBGET integrated database retrieval system