Streptomyces vietnamensis: SVTN_11995 Help Entry SVTN_11995        CDS       T03586                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism svt  Streptomyces vietnamensis Pathway svt00998   Biosynthesis of various antibiotics svt01100   Metabolic pathways svt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SVTN_11995    00074 Mycolic acid biosynthesis     SVTN_11995   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SVTN_11995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AJF65036 UniProt:  A0A0B5HX80 LinkDB All DBs Position 2692655..2692903 Genome browser AA seq 82 aa AA seqDB search MADTQDEILKGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYILKHQD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctgacacccaggacgagatcctcaagggcctcgccgagatcgtcaacgagatcgcg ggcatcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtggccgccgaagagcgcttcgacgtcaagatcccc gacgaggacgtcaagaacctcaagaccgtgggcgacgccgccgactacatcctgaagcac caggactga

DBGET integrated database retrieval system