Streptomyces violaceoruber: B1H20_01475 Help Entry B1H20_01475       CDS       T05124                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism svu  Streptomyces violaceoruber Pathway svu00998   Biosynthesis of various antibiotics svu01100   Metabolic pathways svu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B1H20_01475    00074 Mycolic acid biosynthesis     B1H20_01475   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B1H20_01475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ARF60200 UniProt:  A0A1V0U543 LinkDB All DBs Position complement(331042..331317) Genome browser AA seq 91 aa AA seqDB search MTTIHPKITEVLTGTFKVPAAEILPESTMDSLEMDSLAVAEFAVIIKETLGVSADSEKLY KDATLADITAYIDEAIDSAESEATVPVSNTR NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgacgaccatccaccccaagatcaccgaggtactgaccgggacgttcaaggtgcccgcc gccgagatccttccggagtccaccatggacagcctggagatggactccctcgcggtcgcc gagttcgccgtcatcatcaaggagacgctgggcgtcagcgccgactccgagaagctctac aaggacgccacgctggccgacatcaccgcgtacatcgacgaggccatcgacagcgcggag tccgaagcgacggttccggtgagcaacacccgatga

DBGET integrated database retrieval system